PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g02770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 310aa    MW: 34614.9 Da    PI: 9.2729
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g02770.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.81.1e-32100157260
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                     +++rY+eClkNhAa++Ggh++DGCgEfmp+ geegt++++kCaAC+CHRnFHR+e+e e
  Vang11g02770.1 100 TTFRYRECLKNHAATMGGHVTDGCGEFMPN-GEEGTPESFKCAACECHRNFHRKEPEGE 157
                     578**************************8.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-29102154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-19103153IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.3E-30103153IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.557104153IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466899.79E-19241306IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-29242307IPR009057Homeodomain-like
TIGRFAMsTIGR015654.0E-26245302IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MPSTLGYNLS NRNSSSSKLS SPIGERSDQP PQSHTLIFSD PPQTTSHHHH PLNPPNSLPP  60
NPLQLPHPHR PRRDPDPTPI SPPVITTPRT QPHSTPTFTT TFRYRECLKN HAATMGGHVT  120
DGCGEFMPNG EEGTPESFKC AACECHRNFH RKEPEGESSQ HVLNYHLTYP NKNNRNIVIH  180
SPQSHLQLPT PHLHGVVATP SGGPVQPAML GFGGTPAESS SEDLNMFQTD DAGQLLSVPP  240
LSSSKKRFRT KFSQQQKDKM MEFAEKVGWK IQKQDEQELH QFCSQVGVKR QVFKVWMHNS  300
KQAMKKKQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-212443031675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507547.10.0PREDICTED: zinc-finger homeodomain protein 6-like
TrEMBLA0A0S3R4390.0A0A0S3R439_PHAAN; Uncharacterized protein
STRINGGLYMA02G06270.11e-119(Glycine max)
STRINGGLYMA16G25280.21e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.12e-56homeobox protein 24